CJC-1295 (without DAC).

Price range: £30.00 through £55.00

The same modified GHRH backbone as CJC-1295 (DAC) but lacking the albumin-binding maleimide. ~30 minute serum half-life.

What’s in your box

Pre-filled pen |8 needle tips | 4 alcohol wipes | Handling card | Plain Royal Mail box
SKU: N/A Category:
Guaranteed Safe Checkout for App Payments
Key Features
  • Premium Research Peptides
  • Secure Bank Payments
  • Satisfaction Guarantee
  • Worldwide Shipping
  • Money Back Guarantee

Quick answers to the most-asked questions

Everything researchers usually message us about, answered on the page.

  • 🛡Are your products tested?Janoshik HPLC, every batch

Yes – every batch. Every product we supply is independently HPLC-verified by Janoshik Analytical, a Czech specialist peptide-analysis laboratory unaffiliated with us. Reported purity is consistently above 99%.

Where a Janoshik report has been issued for the current batch, the printed Certificate of Analysis is supplied with the order. Otherwise the verification record is published on our Purity page.

Every COA carries a unique verification key you can authenticate against Janoshik’s own portal at janoshik.com – so you don’t have to take our word for it. We’re the only UK supplier writing publicly about how to read these reports: how to read a Janoshik HPLC report ›

  • 💧How to mix BAC + powderReconstitution in 4 steps
  1. Wipe the vial top. Use one of the alcohol prep wipes from the box. Let it dry.
  2. Draw 2 mL BAC water. Use one of the insulin syringes. Insert the needle through the rubber stopper of the BAC water vial.
  3. Inject the BAC slowly down the inside wall of the peptide vial. Don’t squirt directly onto the powder.
  4. Swirl gently. Don’t shake. Wait 30 seconds for full dissolution. Refrigerate.

Use the reconstitution card on the inside of the box lid as your reference next time.

  • 💉How to use the penDose dial, clicks, priming
  1. Attach a fresh needle. Wipe the needle end of the pen with an alcohol prep wipe. Screw a foil-wrapped needle from the box onto the threaded tip.
  2. Prime the needle. Dial up 1 click, point the needle upwards, press the dose button. A drop of solution at the needle tip confirms the pen is primed and any air is expelled.
  3. Dial your research dose. Each click on the dose dial delivers a fixed increment. Click resolution is typically 0.5–1 mg per click depending on calibration; the dose window shows your total dialled dose. For example, a 6 mg research dose is roughly 6–12 clicks.
  4. Administer at the route used in published research. Cohort protocols use subcutaneous administration (abdomen, thigh, upper arm). Hold for ~6 seconds before withdrawing.
  5. Discard the needle in a sharps container. Cap the pen and return to refrigerated storage.

One pen lasts the number of doses shown in the protocol cards above for your selected size. When it’s empty, drop a refill cartridge into the same pen body – price for your size is in the calculator at the top.

Research use only. Procedure drawn from published cohort protocols. We do not provide medical or human-use guidance.

  • StorageLyophilised + reconstituted

Lyophilised vial: stable 24+ months at 2–8 °C, sealed and protected from light. Don’t freeze.

Reconstituted (after BAC water): ~30 days at 2–8 °C. Don’t shake. Keep in original glass vial. Discard if cloudy or discoloured.

BAC water bottle: 30 days once opened, refrigerated.

  • 📍Administration in researchRoute used in published studies

Published research literature on CJC-1295 (without DAC) uses subcutaneous administration in the abdomen, thigh or upper arm in human pharmacokinetic and Phase 2 / 3 studies. Researchers rotate sites between administrations to reduce local tissue stress.

Research use only. The route information above is drawn from published peer-reviewed literature for context. We do not provide human-use guidance, dosing protocols, or administration instructions.

Reference: Sackmann-Sala et al. 2009

  • 🎯What should my dose be?Straight answer, no fluff

The clean answer: follow the protocol cards above. Published research literature on CJC-1295 (without DAC) uses titration – start low, step up at fixed weekly intervals. The phase highlighted in green is where most published research cohorts settle for ongoing study.

If you’re new to this compound: start at Phase 1 (the lowest dose shown above) for the full duration of that phase, then step up to the next. The titration is what limits the GI side effects reported in the trial – don’t skip it.

If you’ve used this compound before: you already know which phase you’re at. Tap the phase tabs above to see exactly what your dose costs at your selected vial or pen size, plus how long it will last.

If your protocol is non-standard: WhatsApp us before you order. We help researchers work out custom schedules every day and will tell you which size makes most sense for the cadence you’re running. Real human reply, not a chatbot.

Ask us on WhatsApp ›

Research use only. The dosing described is drawn from published peer-reviewed cohort literature for context. We do not provide medical or human-use guidance. If you are evaluating this compound for human use, consult a qualified medical practitioner. Reference: Sackmann-Sala et al. 2009

Key Information

Compound CJC 1295 (without DAC)
Research category GHRH / Secretagogue Research
Available sizes 2mg, 5mg, 10mg
Pricing From £25
Format Lyophilised powder in sealed vial
Purity >99% by HPLC (Janoshik Analytical, batch-verified)
Intended use In-vitro laboratory research only. Not for human consumption.

Chemical & Reference Data

Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.

Compound class Synthetic GHRH analogue (Modified GRF 1-29) without DAC modification
Molecular formula C152H252N44O42
Molecular weight 3367.9 g/mol
CAS Registry Number 863288-34-0
Number of residues 29
Amino acid sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 with D-Ala²-Gln⁸-Ala¹⁵-Leu²⁷ substitutions.
Receptor / mechanism GHRH receptor agonist (modified GHRH 1-29).
Reported half-life Reported ~30 minutes in human serum.
Solubility Lyophilised powder reconstitutes in bacteriostatic water for laboratory use.
Storage (lyophilised) Stable at 2–8 °C lyophilised for 24+ months.
Storage (reconstituted) Reconstituted: store at 2–8 °C, use within 14 days.
Clinical / regulatory status Investigational research compound.

Research Profile

  • Mod GRF 1-29
  • Stabilised GHRH analogue
  • Four amino-acid substitutions
  • Third-party purity tested
  • Research use only

CJC 1295 without DAC, also known in the literature as Mod GRF 1-29, is a synthetic GHRH analogue comprising the first 29 amino acids of GHRH with four amino-acid substitutions for stability. Supplied as lyophilised powder for in-vitro research use only.

The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans. buy CJC-1295 without DAC

Laboratory Handling

CJC 1295 (without DAC) is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved – do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.

Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.

State Temperature Shelf life
Lyophilised 2–8 °C or −20 °C Up to 24 months
Reconstituted 2–8 °C 4–6 weeks typical

Purity & Verification

Every batch of CJC 1295 (without DAC) we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik’s records. Reported purity is consistently above 99%. buy CJC-1295 without DAC

Related Compounds

Researchers working with CJC 1295 (without DAC) often work alongside the following compounds in the preclinical literature:

  • CJC 1295 (with DAC) – GHRH / Secretagogue Research
  • Sermorelin – GHRH / Secretagogue Research
  • Ipamorelin – GHRH / Secretagogue Research

Compare CJC 1295 (without DAC) with Related Compounds

  • Compare CJC 1295 (without DAC) vs CJC 1295 (with DAC) – side-by-side mechanism, pricing and lab handling.
  • Compare CJC 1295 (without DAC) vs Ipamorelin – side-by-side mechanism, pricing and lab handling. buy CJC-1295 without DAC
Size

5mg, 10mg

Format

Pen, Vial

Reviews

There are no reviews yet.

Be the first to review “CJC-1295 (without DAC).”

Your email address will not be published. Required fields are marked *

Unlimited Delivery: £6.75 - Limited Time Only | UK Duty-Paid Peptides.