Black & White Peptides Ltd. Registered in England & Wales, company number 16876162.
Liraglutide
Price range: £60.00 through £80.00
A long-acting GLP-1 receptor agonist with palmitic-acid acylation. Once-daily research administration profile.
What’s in your box
Key Features
- Premium Research Peptides
- Secure Bank Payments
- Satisfaction Guarantee
- Worldwide Shipping
- Money Back Guarantee
Quick answers to the most-asked questions
Everything researchers usually message us about, answered on the page
- 🛡Are your products tested?Janoshik HPLC, every batch
Yes – every batch. Every product we supply is independently HPLC-verified by Janoshik Analytical, a Czech specialist peptide-analysis laboratory unaffiliated with us. Reported purity is consistently above 99%.
Where a Janoshik report has been issued for the current batch, the printed Certificate of Analysis is supplied with the order. Otherwise the verification record is published on our Purity page.
Every COA carries a unique verification key you can authenticate against Janoshik’s own portal at janoshik.com – so you don’t have to take our word for it. We’re the only UK supplier writing publicly about how to read these reports: how to read a Janoshik HPLC report ›
- How to mix BAC + powder
- Wipe the vial top. Use one of the alcohol prep wipes from the box. Let it dry.
- Draw 2 mL BAC water. Use one of the insulin syringes. Insert the needle through the rubber stopper of the BAC water vial.
- Inject the BAC slowly down the inside wall of the peptide vial. Don’t squirt directly onto the powder.
- Swirl gently. Don’t shake. Wait 30 seconds for full dissolution. Refrigerate.
Use the reconstitution card on the inside of the box lid as your reference next time.
- How to use the pen
- Attach a fresh needle. Wipe the needle end of the pen with an alcohol prep wipe. Screw a foil-wrapped needle from the box onto the threaded tip.
- Prime the needle. Dial up 1 click, point the needle upwards, press the dose button. A drop of solution at the needle tip confirms the pen is primed and any air is expelled.
- Dial your research dose. Each click on the dose dial delivers a fixed increment. Click resolution is typically 0.5–1 mg per click depending on calibration; the dose window shows your total dialled dose. For example, a 6 mg research dose is roughly 6–12 clicks.
- Administer at the route used in published research. Cohort protocols use subcutaneous administration (abdomen, thigh, upper arm). Hold for ~6 seconds before withdrawing.
- Discard the needle in a sharps container. Cap the pen and return to refrigerated storage.
One pen lasts the number of doses shown in the protocol cards above for your selected size. When it’s empty, drop a refill cartridge into the same pen body – price for your size is in the calculator at the top.
Research use only. Procedure drawn from published cohort protocols. We do not provide medical or human-use guidance.
- Storage
Lyophilised vial: stable 24+ months at 2–8 °C, sealed and protected from light. Don’t freeze.
Reconstituted (after BAC water): ~30 days at 2–8 °C. Don’t shake. Keep in original glass vial. Discard if cloudy or discoloured.
BAC water bottle: 30 days once opened, refrigerated.
- Administration in research
Published research literature on Liraglutide uses subcutaneous administration in the abdomen, thigh or upper arm in human pharmacokinetic and Phase 2 / 3 studies. Researchers rotate sites between administrations to reduce local tissue stress.
Research use only. The route information above is drawn from published peer-reviewed literature for context. We do not provide human-use guidance, dosing protocols, or administration instructions.
Reference: Pi-Sunyer et al. 2015 (NEJM)
- What should my dose be?
The clean answer: follow the protocol cards above. Published research literature on Liraglutide uses titration – start low, step up at fixed weekly intervals. The phase highlighted in green is where most published research cohorts settle for ongoing study.
If you’re new to this compound: start at Phase 1 (the lowest dose shown above) for the full duration of that phase, then step up to the next. The titration is what limits the GI side effects reported in the trial – don’t skip it.
If you’ve used this compound before: you already know which phase you’re at. Tap the phase tabs above to see exactly what your dose costs at your selected vial or pen size, plus how long it will last.
If your protocol is non-standard: WhatsApp us before you order. We help researchers work out custom schedules every day and will tell you which size makes most sense for the cadence you’re running. Real human reply, not a chatbot.
Research use only. The dosing described is drawn from published peer-reviewed cohort literature for context. We do not provide medical or human-use guidance. If you are evaluating this compound for human use, consult a qualified medical practitioner. Reference: Pi-Sunyer et al. 2015 (NEJM)
Key Information
| Compound | Liraglutide |
| Research category | Metabolic Research |
| Available sizes | 5mg, 10mg, 30mg |
| Pricing | From £40 |
| Format | Lyophilised powder in sealed vial |
| Purity | >99% by HPLC (Janoshik Analytical, batch-verified) |
| Intended use | In-vitro laboratory research only. Not for human consumption. |
Chemical & Reference Data
Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.
| Compound class | Synthetic 31-amino-acid GLP-1 receptor agonist peptide (~97% homology with native GLP-1) |
| Molecular formula | C172H265N43O51 |
| Molecular weight | 3751.2 g/mol |
| CAS Registry Number | 204656-20-2 |
| PubChem CID | 16134956 |
| Number of residues | 31 |
| Amino acid sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (Lys26 acylated with γGlu-C16) |
| Receptor / mechanism | GLP-1 receptor agonist (single-target). |
| Reported half-life | Reported ~13 hours in human serum in published literature. |
| Solubility | Lyophilised powder reconstitutes in bacteriostatic water for laboratory use. |
| Storage (lyophilised) | Stable at 2–8 °C lyophilised for 24+ months. |
| Storage (reconstituted) | Reconstituted: store at 2–8 °C, use within 28 days. |
| Clinical / regulatory status | Approved by FDA (2010) for research-relevant metabolic indications. |
Research Profile
- GLP-1 receptor agonist
- ~97% homology with native GLP-1
- Lipopeptide modification
- Third-party purity tested
- Research use only
Liraglutide is a synthetic GLP-1 receptor agonist with approximately 97% sequence homology to native human GLP-1. Characterised in the research literature as a lipopeptide modification of the parent sequence. Supplied as lyophilised powder for in-vitro research use only.
The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans.
Laboratory Handling
Liraglutide is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved – do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.
Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.
| State | Temperature | Shelf life |
|---|---|---|
| Lyophilised | 2–8 °C or −20 °C | Up to 24 months |
| Reconstituted | 2–8 °C | 4–6 weeks typical |
Purity & Verification
Every batch of Liraglutide we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik’s records. Reported purity is consistently above 99%.
Related Compounds
Researchers working with Liraglutide often work alongside the following compounds in the preclinical literature:
- Tirzepatide – Metabolic Research
- Semaglutide – Metabolic Research
- Mazdutide – Metabolic Research
Compare Liraglutide with Related Compounds
- Compare Liraglutide vs Semaglutide – side-by-side mechanism, pricing and lab handling.
Key Literature References
- Knudsen LB et al. Potent derivatives of glucagon-like peptide-1 with pharmacokinetic properties suitable for once daily administration (2000). (PMID: 10805799) →
References are independent peer-reviewed sources. Black & White Peptides Ltd is not affiliated with these publications.
| SIZE | 5mg, 10mg |
|---|
Be the first to review “Liraglutide”
Related products
-
5-Amino-1MQ.
Price range: £41.00 through £76.00 Select options This product has multiple variants. The options may be chosen on the product page -
Adipotide.
Price range: £55.00 through £75.00 Select options This product has multiple variants. The options may be chosen on the product page -
AICAR.
£60.00 Select options This product has multiple variants. The options may be chosen on the product page -
Cagrilintide.
£96.00 Select options This product has multiple variants. The options may be chosen on the product page
Reviews
There are no reviews yet.